Yeast RPB5 protein

SKU: orb605167

Description

Recombinant Kluyveromyces marxianus DNA-directed RNA polymerases I, II, and III subunit RPABC1(RPB5)

Research Area

Product Categories/Products/Proteins,Epigenetics and Nuclear Signaling

Images & Validation

• Application Notes:
  Full Length

Key Properties

• Source: E.coli
• Biological Origin: Kluyveromyces marxianus (Yeast) (Candida kefyr)
• Tag: N-terminal 6xHis-tagged
• Expression Region: 1-215aa
• Protein Length: Full Length
• Endotoxins: Not test.
• MW: 29.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RPB5, DNA-directed RNA polymerases I, II, and III subunit RPABC1, RNA polymerases I, II, and III subunit ABC1

Quick Database Links

UniProt

Q9P4B9