AIF Antibody

SKU: orb1176976

Description

Rabbit polyclonal antibody to AIFM1

Research Area

,Product Categories/Antibodies

Images & Validation

• Tested Applications: ICC, IHC-P, WB
• Dilution Range: Western blot: 0.1-0.5μg/ml. Immunohistochemistry(Paraffin-embedded Section): 0.5-1μg/ml. Immunocytochemistry: 0.5-1μg/ml
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
• Target: AIFM1
• Conjugation: Unconjugated

Storage & Handling

• Storage: At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing
• Form/Appearance: Lyophilized
• Buffer/Preservatives: Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AIFM1 antibody, AIFM1_HUMAN antibody, Apoptosis inducing factor 1, mitochondrial antibody, Apoptosis inducing factor antibody, Apoptosis inducing factor, mitochondrion associated, 1 antibody, Apoptosis-inducing factor 1 antibody, CMTX4 antibody, COXPD6 antibody, Harlequin antibody, Hq antibody, mAIF antibody, MGC111425 antibody, MGC5706 antibody, mitochondrial antibody, Neuropathy, axonal motor-sensory, with deafness and mental retardation antibody, neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome) antibody, PDCD 8 antibody, PDCD8 antibody, Programmed cell death 8 (apoptosis inducing factor) antibody, Programmed cell death 8 antibody, Programmed cell death 8 isoform 1 antibody, Programmed cell death 8 isoform 2 antibody, Programmed cell death 8 isoform 3 antibody, Programmed cell death protein 8 antibody, Programmed cell death protein 8 mitochondrial antibody, Programmed cell death protein 8 mitochondrial precursor antibody, Striatal apoptosis inducing factor antibody

Quick Database Links

Gene Symbol

AIFM1