Anti-CD63

SKU: orb11597

Featured

Description

CD63 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of the members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker.

Images & Validation

−

Item 1 of 2

Tested Applications	IF, IHC-Fr, IHC-P, WB
Dilution Range	WB:1:500-1:5,000, IF:1:25-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
Reactivity	Canine, Human, Monkey, Mouse, Rat
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Antibody Type	Primary Antibody
Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli.. Antigen Sequence: MENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCI
Target	Lysosome-associated membrane glycoprotein 3
Conjugation	Unconjugated

Customer Validated Data

−

The data below is submitted by researchers worldwide. We provide this transparency to help you decide if this product works for your specific application or species, even if we haven't tested it ourselves.

Success by Application

Reactivity Distribution

Latest Experiments

6 Results

Dilution

Sample

Summary

Human

1:1000

ARPE‑19 cell lysates and sEVs isolated from conditioned medium

Cells or sEV pellets are lysed...

IHC

Mouse

1:300

Brain tissue

Tissue sections were deparaffinized, rehydrated, and...

Human

1:500

EV pellets from HEK‑293 cells

EVs are lysed in non‑reducing loading...

Mouse

1:100

Brain tissue sections from 5xFAD mouse

Brain sections are fixed, permeabilised, blocked,...

Mouse

1:1000

BV2 microglial cell line

Cell lysates or EV proteins are...

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	PBS, 20% glycerol and 0.05% sodium azide
Concentration	1 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

CD63 antigen, CD63 antigen (melanoma 1 antigen), granulophysin, LAMP-3, lysosomal-associated membrane protein 3, lysosome-associated membrane glycoprotein 3, ME491, melanoma-associated antigen, melanoma 1 antigen, melanoma-associated antigen ME491, MLA1, ocular melanoma-associated antigen, OMA81H, tetraspanin-30, TSPAN30 antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].