Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

APOE Rabbit Polyclonal Antibody

SKU: orb333723

Description

Rabbit polyclonal antibody to Apolipoprotein E

Research Area

Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Signaling Pathways/Alzheimer's,Epigenetics,Neuroscience,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling,Root Catalog/Research Areas/Mitochondria,Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Research Areas/GPCR,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityRat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetAPOE
Protein SequenceSynthetic peptide located within the following region: LMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVC
Molecular Weight36 kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE antibody, Anti-APOE_HUMAN antibody, Anti-APOEA antibody, Anti-Apolipoprotein E antibody, Anti-Apolipoprotein E3 antibody, Anti-ApolipoproteinE antibody, Anti-Apoprotein antibody, Anti-LDLCQ5 antibody, Anti-LPG antibody

Similar Products

  • APOE Rabbit Polyclonal Antibody [orb333722]

    IHC,  WB

    Human

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Apolipoprotein E Rabbit Polyclonal Antibody [orb1144]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • Anti-Apolipoprotein E Antibody [orb213571]

    IF,  IH,  WB

    Human, Mouse, Primate, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl
  • ApoE rabbit pAb [orb768721]

    ELISA,  IHC-P,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • APOE Antibody (C-term) [orb1929129]

    IHC-P,  WB

    Rabbit

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

APOE Rabbit Polyclonal Antibody

Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

APOE Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

APOE Rabbit Polyclonal Antibody

APOE antibody - N-terminal region (orb333723) validated by WB using 721_B cell lysate at 1.0 ug/ml. There is BioGPS gene expression data showing that APOE is expressed in 721_B.

APOE Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000032

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

APOE Rabbit Polyclonal Antibody (orb333723)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry