You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FAH |
| Target | FAH |
| Protein Sequence | Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
| Molecular Weight | 46 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−FAH Rabbit Polyclonal Antibody [orb578162]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlAnti-Fumarylacetoacetase Antibody [orb341119]
IF, IH, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

Immunohistochemistry with human kidney.

Immunohistochemistry with human liver.

Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400.

WB Suggested Anti-FAH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.
Documents Download
Request a Document
Protocol Information
FAH Rabbit Polyclonal Antibody (orb578161)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











![FANCA antibody [N1], N-term](/images/pub/media/catalog/product/f/a/fanca-antibody_orb556852_ifa_1.jpg)
![FANCA antibody [N1], N-term](/images/pub/media/catalog/product/f/a/fanca-antibody_orb556852_ihc_1.jpg)
![FANCA antibody [N1], N-term](/images/pub/media/catalog/product/f/a/fanca-antibody_orb556852_wb_1.jpg)


