You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FAH |
| Target | FAH |
| Protein Sequence | Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
| Molecular Weight | 46kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−FAH Rabbit Polyclonal Antibody [orb578161]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Porcine, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlAnti-Fumarylacetoacetase Antibody [orb341119]
IF, IH, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FAH antibody - C-terminal region (orb578162) validated by WB using Jurkat cell lysate at 2.5 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with human liver, mouse KO tissue.

Immunohistochemistry with human liver, mouse KO tissue.

Rabbit Anti-FAH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400.
Documents Download
Request a Document
Protocol Information
FAH Rabbit Polyclonal Antibody (orb578162)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review















![FANCA antibody [N1], N-term](/images/pub/media/catalog/product/f/a/fanca-antibody_orb556852_ifa_1.jpg)
![FANCA antibody [N1], N-term](/images/pub/media/catalog/product/f/a/fanca-antibody_orb556852_ihc_1.jpg)
![FANCA antibody [N1], N-term](/images/pub/media/catalog/product/f/a/fanca-antibody_orb556852_wb_1.jpg)


