G6PC Rabbit Polyclonal Antibody

SKU: orb579094

Description

Rabbit polyclonal antibody to G6PC

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Signal Proteins,Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling,Root Catalog/Products/Polyclonal Antibodies/Membrane Protein,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Research Areas/Receptors,Root Catalog/Research Areas/Phosphorylation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
• Target: G6PC
• Protein Sequence: Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
• Molecular Weight: 40 kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

G6PC, G6PT, GSD1, GSD1a, G6Pase

Immunohistochemistry with Human kidney lysate tissue.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is glycosylated.

Formalin Fixed Paraffin Embedded Tissue: Normal human kidney, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

Formalin Fixed Paraffin Embedded Tissue: Normal human liver, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

Sample Tissue: Human HL-60 Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): Human kidney (KI), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.

WB Suggested Anti-G6PC Antibody Titration: 1 ug/ml, Positive Control: Fetal Lung cell lysate.

Quick Database Links

Gene Symbol

G6PC

UniProt

P35575

RefSeq (Protein):NP_000142