You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 23-126aa |
| Protein Length | Extracellular Domain |
| Endotoxins | Not test. |
| MW | 13.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Cyn. monkey CD3E & CD3G protein, C-hFc (HEK293) [orb1516501]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation,the protein migrates to 44-46 & 46-48 kDa based on Tris-Bis PAGE result. kDa
100 μg, 50 μgRecombinant Cyn. monkey CD3E & CD3D protein, C-hFc (HEK293) [orb1516502]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation,the protein migrates to 58-62 and 44-46 kDa based on Tris-Bis PAGE result. kDa
100 μg, 50 μgHuman CD3D Protein, His Tag and Human CD3E Protein, hFc Tag [orb1743385]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 10.4 and 37.9 kDa after removal of the signal peptide. The apparent molecular mass of CD3D-His and CD3E-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgRecombinant Cyn. monkey CD3E protein, C-His (HEK293) [orb1516476]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 14-16 kDa based on Tris-Bis PAGE result. kDa
100 μgRecombinant Cyn. monkey CD3E protein, C-hFc (HEK293) [orb1516475]
> 95% as determined by Tris-Bis PAGE
Due to glycosylation, the protein migrates to 43-48 kDa based on Tris-Bis PAGE result. kDa
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].















