You have no items in your shopping cart.
Human CSF3 protein (Active)
SKU: orb359027
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 18.7 kDa |
| Expression Region | 31-204aa |
| Protein Length | Full Length of Mature Protein of Isoform Short |
| Protein Sequence | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 10mM sodium acetate buffer, containing 5 % trehalose, pH 4.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−G-CSF, Filgrastim, Lenograstim
Similar Products
−Human CSF3 protein [orb594717]
Greater than 95% as determined by SDS-PAGE.
18.8 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μgRecombinant human G-CSF protein (Active, HEK293) [orb1817178]
> 95% as determined by SDS-PAGE
21-25 kDa
10 μg, 50 μg, 500 μgRecombinant Human Granulocyte colony-stimulating factor protein(CSF3) (Active) [orb1650771]
10 μg, 100 μg, 1 mg, 250 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CSF3 protein (Active) (orb359027)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
