Human CSF3 protein

SKU: orb594717

Description

Recombinant Human Granulocyte colony-stimulating factor(CSF3),partial (Active)

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Cancer

Images & Validation

• Application Notes:
  Partial of Isoform 2

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells is 0.03 ng/ml.
• Tag: Tag-Free
• Molecular Weight: 18.8 kDa
• Expression Region: 31-204aa
• Protein Length: Partial of Isoform 2
• Protein Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF

Quick Database Links

UniProt

P09919