You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 29-209 |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 23.4 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human FGF21 protein (Active) [orb359158]
> 96% as determined by SDS-PAGE and HPLC.
19.4 kDa
E.Coli
5 μg, 100 μg, 500 μgRecombinant human FGF21 protein, N-mFc-Avi (HEK293) [orb1516454]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 52-60 kDa based on Tris-Bis PAGE result. kDa
100 μgHuman FGF21 Protein, hFc Tag [orb1290908]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 45.5 kDa after removal of the signal peptide. The apparent molecular mass of FGF21-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman FGF 21 protein [orb80028]
SDS-PAGE
Unconjugated
> 95.0% as determined by RP-HPLC and analysis by SDS-PAGE
500 μg, 5 μg, 100 μgRat FGF-21 protein [orb107723]
HPLC, SDS-PAGE
Unconjugated
> 95 % by SDS-PAGE and HPLC analyses
19.7 kDa
5 μg, 100 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].





