You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Signal Transduction
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-B2M-tagged |
| Expression Region | 34-189aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 32.2 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | DMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Heparin-binding growth factor 7
Similar Products
−- Item 1 of 1
Human FGF7 protein (Active) [orb359153]
> 96% as determined by SDS-PAGE and HPLC.
18.9 kDa
E.Coli
100 μg, 10 μg, 500 μg - Item 1 of 1
Human KGF (C-6His) Protein [orb1471764]
Greater than 95% as determined by reducing SDS-PAGE.
20 KDa
Mammalian
10 μg, 50 μg - Item 1 of 1
- Item 1 of 1
Human Keratinocyte Growth Factor protein [orb80085]
FA, HPLC, SDS-PAGE
Unconjugated
> 98.0% as determined by RP-HPLC and analysis by SDS-PAGE
10 μg, 100 μg, 500 μg Human FGF7 protein [orb706940]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks