Human IL4R protein

SKU: orb594782

Description

Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active)

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Immunology

Images & Validation

• Application Notes:
  Extracellular Domain

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: ①The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-20 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized Human IL-4 RA-Fc at 5μg/ml can bind Human IL-4 (Biotinylated by NHS-biotin prior to testing), the ED50 of Human IL-4 is 2.43 ng/ml.
• Tag: C-terminal Fc-tagged
• Molecular Weight: 50.2 kDa
• Expression Region: 26-231aa
• Protein Length: Extracellular Domain
• Protein Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA

Quick Database Links

UniProt

P24394