You have no items in your shopping cart.
Human TNF protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 30-150 pg/ml. |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 21.8 kDa |
| Expression Region | 57-233aa |
| Protein Length | Extracellular Domain |
| Protein Sequence | GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 100 mM NaCl, pH 7.2 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Anti-Tropomyosin 2/TPM2 Antibody [orb1291659]
FC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
10 μg, 100 μgHuman TNFSF13B protein [orb705331]
Greater than 93% as determined by SDS-PAGE.
46.6 kDa
Mammalian cell
20 μg, 100 μg, 1 mgRecombinant Human Tumor necrosis factor (TNF) Protein [orb624131]
Greater than 90% as determined by SDS-PAGE.
19.4 kDa
Yeast
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human TNF protein (orb594842)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

























