You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BB-Fc-His at 2μg/ml can bind Anti-Human CD137 mAb, the ED50 of Anti-Human CD137 mAb is 0.41ug/ml. |
| Tag | C-terminal 6xHis-Fc-tagged |
| Expression Region | 24-186aa |
| Protein Length | Extracellular Domain |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 44 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant human TNFRSF9 protein, C-His-Avi (HEK293), Biotin conjugated [orb2328773]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 35-45 kDa based on Tris-Bis PAGE result. kDa
20 μg, 100 μgCynomolgus 4-1BB Protein, hFc Tag [orb1826724]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide. The apparent molecular mass of c4-1BB-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman TNFRSF9 ELISA Kit [orb340032]
Human
7.8 pg/mL-500 pg/mL
1.95 pg/mL
10 x 96 T, 24 T, 48 T, 96 T, 5 x 96 THuman TNFRSF9 protein [orb594868]
Greater than 95% as determined by SDS-PAGE.
18.1 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human TNFRSF9 protein (orb594867)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




