You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Loaded Human 4-1BB-His on HIS1K Biosensor, can bind Anti-Human CD137 mAb-Fc with an affinity constant of 25.5 nM as determined in BLI assay. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 24-186aa |
| Protein Length | Extracellular Domain |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 18.1 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant human TNFRSF9 protein, C-His-Avi (HEK293), Biotin conjugated [orb2328773]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 35-45 kDa based on Tris-Bis PAGE result. kDa
20 μg, 100 μgCynomolgus 4-1BB Protein, hFc Tag [orb1826724]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide. The apparent molecular mass of c4-1BB-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman TNFRSF9 ELISA Kit [orb340032]
Human
7.8 pg/mL-500 pg/mL
1.95 pg/mL
10 x 96 T, 24 T, 48 T, 96 T, 5 x 96 THuman TNFRSF9 protein [orb594867]
Greater than 95% as determined by SDS-PAGE.
44 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].





