You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mouse |
| Target | FGF basic |
| Protein Length | 144 |
| MW | 16.2 kDa |
| Purity | 98% |
| Protein Sequence | ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (144) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−FGF-2
Similar Products
−- Item 1 of 1
Mouse Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit [orb778804]
Mouse
15.63-1000 pg/mL
4.54 pg/mL
96 T, 48 T 
Mouse Fgf-2 protein [orb704601]
Greater than 90% as determined by SDS-PAGE.
20.3 kDa
E.coli
20 μg, 100 μg, 1 mgMouse Fgf2 Protein [orb1476888]
Greater than 85% as determined by SDS-PAGE.
18.9 kDa
Yeast
1 mg, 20 μg, 100 μgMouse Fgf2 protein [orb594760]
Greater than 95% as determined by SDS-PAGE.
17.15 kDa
E.coli
500 μg, 1 mg, 10 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days