You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Epigenetics,Developmental Biology,Signal Transduction
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-1.8 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 1-154aa |
| Protein Length | Full Length |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 17.15 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2
Similar Products
−- Item 1 of 1
Mouse Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit [orb778804]
Mouse
15.63-1000 pg/mL
4.54 pg/mL
96 T, 48 T Mouse Fgf-2 protein [orb704601]
Greater than 90% as determined by SDS-PAGE.
20.3 kDa
E.coli
20 μg, 100 μg, 1 mgMouse Fgf2 Protein [orb1476888]
Greater than 85% as determined by SDS-PAGE.
18.9 kDa
Yeast
1 mg, 20 μg, 100 μgMouse FGF2 protein [orb391730]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks