Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Mouse SCF protein (Active)

SKU: orb359034
ActiveBiologically Active

Description

Recombinant mouse SCF active protein

Research Area

Product Categories/Products/ELISA Kits,Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceE.Coli
Biological OriginMus musculus (Mouse)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 105 IU/mg.
TagTag-Free
Expression Region26-189aa
Protein LengthPartial
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.
MW18.4 kDa
Purity> 97% as determined by SDS-PAGE and HPLC.
Protein SequenceM+KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Hematopoietic growth factor KL, MGF, Steel factor, Stem cell factor, SCF

Similar Products

  • Mouse Kitlg protein [orb594761]

    Greater than 95% as determined by SDS-PAGE.

    18.4 kDa

    E.coli

    1 mg, 500 μg, 50 μg, 10 μg
  • Rat SCF protein [orb107801]

    HPLC,  SDS-PAGE

    Unconjugated

    > 95% by SDS-PAGE and HPLC analyses

    18.5 kDa

    10 μg, 100 μg, 500 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

10 μg
$ 400.00
100 μg
$ 920.00
500 μg
$ 1,980.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry