Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Mouse TNF alpha Recombinant Protein

SKU: orb1820708

Description

The Mouse TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TNF alpha Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)) (Gene ID: 21926).

Images & Validation

Key Properties

SourceYeast
Biological OriginMouse
TargetTNF alpha
Protein Length156
MW17.3 kDa
Purity98%
Protein SequenceLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TNFSF2

Similar Products

  • Mouse Tnf protein [orb594857]

    Greater than 95% as determined by SDS-PAGE.

    16.4 kDa

    E.coli

    1 mg, 500 μg, 10 μg, 50 μg
  • Mouse Lta protein [orb705253]

    Greater than 85% as determined by SDS-PAGE.

    23.8 kDa

    E.coli

    100 μg, 1 mg, 20 μg
  • Mouse Lta protein [orb604233]

    Greater than 85% as determined by SDS-PAGE.

    23.6 kDa

    E.coli

    20 μg, 100 μg, 1 mg
  • Mouse Tnf protein [orb54123]

    Greater than 90% as determined by SDS-PAGE.

    35.7 kDa

    E.coli

    20 μg, 100 μg, 1 mg
  • Recombinant mouse TNF-Alpha protein, N-His [orb1516920]

    > 95% as determined by SDS-PAGE

    17 kDa

    500 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

500 μg
$ 4,260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry