You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | NT5E |
| Protein Sequence | Synthetic peptide located within the following region: KAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVP |
| Molecular Weight | 63 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CD73 Rabbit Polyclonal Antibody [orb2931]
FC, WB
Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat, Sheep
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recognizes both the 63 kDa preprotein as well as the processed 57 kDa mature form of these proteins.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-NT5E Antibody, Titration: 1.0 ug/mL, Positive Control: 721_B Whole Cell.
Documents Download
Request a Document
NT5E Rabbit Polyclonal Antibody (orb326519)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

















