Rabbit CTLA-4 Recombinant Protein

SKU: orb1819615

Description

The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Rabbit
Target	CTLA-4
Protein Length	124
MW	13.5 kDa
Purity	98%
Protein Sequence	LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

CTLA-4

NCBI Gene ID

100009412

NCBI Gene Details

−

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Applications:	IF, IHC, WB
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Recombinant
Conjugation:	Unconjugated

Applications:	IF, IHC, WB
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Recombinant
Conjugation:	Unconjugated

Applications:	ELISA, IHC
Reactivity:	Human
Clonality:	Monoclonal
Conjugation:	Unconjugated

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Rabbit CTLA-4 Recombinant Protein

Description

Images & Validation

Key Properties

Storage & Handling

Similar Products

Rabbit anti-CTLA4 Recombinant Monoclonal Antibody [BLR257L] [orb1784582]

Rabbit anti-CTLA4 Recombinant Monoclonal Antibody [BLR257L] [orb1784584]

CTLA4 Recombinant Monoclonal Antibody [orb689110]

Rabbit CD80 protein [orb707311]

Rabbit CD86 protein [orb707312]

Quality Guarantee

Quick Database Links

NCBI Gene Details

Protocol Information

Available Sizes

Email

UK Office

US Office

CN Office

Distributors