You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| MW | 17.3 kDa |
| Protein Sequence | LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Mouse Tnf protein [orb594857]
Greater than 95% as determined by SDS-PAGE.
16.4 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μgMouse Lta protein [orb705253]
Greater than 85% as determined by SDS-PAGE.
23.8 kDa
E.coli
100 μg, 1 mg, 20 μgMouse Lta protein [orb604233]
Greater than 85% as determined by SDS-PAGE.
23.6 kDa
E.coli
20 μg, 100 μg, 1 mgMouse Tnf protein [orb54123]
Greater than 90% as determined by SDS-PAGE.
35.7 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant mouse TNF-Alpha protein, N-His [orb1516920]
> 95% as determined by SDS-PAGE
17 kDa
500 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

