You have no items in your shopping cart.
Description
Research Area
,Product Categories/Proteins
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Purity | Greater than 98.0% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS |
Storage & Handling
−| Storage | Stability: Streptavidin is shipped at ambient temperature, upon arrival store at -20°C |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized in 10mM potassium phosphate buffer pH 6.5. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 10
- Item 1 of 2
- Item 1 of 1
Streptavidin protein [orb82632]
FA, HPLC, SDS-PAGE
Unconjugated
< p>> 98% pure by SDS-PAGE and HPLC analyses.
7.6 kDa
100 mg, 1 mg, 25 mg Virus Streptomyces avidinii Streptavidin protein [orb604640]
Greater than 90% as determined by SDS-PAGE.
43.5 kDa
E.coli
20 μg, 100 μg, 1 mgBacterial Streptavidin protein [orb383014]
Greater than 90% as determined by SDS-PAGE.
18.5 kDa
Yeast
1 mg, 20 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days